Description
Product Description
Protein Description: homeobox D12
Gene Name: HOXD12
Alternative Gene Name: HOX4H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001823: 75%, ENSRNOG00000001587: 75%
Entrez Gene ID: 3238
Uniprot ID: P35452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXD12
Alternative Gene Name: HOX4H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001823: 75%, ENSRNOG00000001587: 75%
Entrez Gene ID: 3238
Uniprot ID: P35452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTRPSFAPESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPL |
Gene Sequence | RTRPSFAPESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPL |
Gene ID - Mouse | ENSMUSG00000001823 |
Gene ID - Rat | ENSRNOG00000001587 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HOXD12 pAb (ATL-HPA059444) | |
Datasheet | Anti HOXD12 pAb (ATL-HPA059444) Datasheet (External Link) |
Vendor Page | Anti HOXD12 pAb (ATL-HPA059444) at Atlas Antibodies |
Documents & Links for Anti HOXD12 pAb (ATL-HPA059444) | |
Datasheet | Anti HOXD12 pAb (ATL-HPA059444) Datasheet (External Link) |
Vendor Page | Anti HOXD12 pAb (ATL-HPA059444) |