Description
Product Description
Protein Description: homeobox D1
Gene Name: HOXD1
Alternative Gene Name: HOX4, HOX4G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042448: 67%, ENSRNOG00000001572: 71%
Entrez Gene ID: 3231
Uniprot ID: Q9GZZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXD1
Alternative Gene Name: HOX4, HOX4G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042448: 67%, ENSRNOG00000001572: 71%
Entrez Gene ID: 3231
Uniprot ID: Q9GZZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS |
Gene Sequence | REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS |
Gene ID - Mouse | ENSMUSG00000042448 |
Gene ID - Rat | ENSRNOG00000001572 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HOXD1 pAb (ATL-HPA056900) | |
Datasheet | Anti HOXD1 pAb (ATL-HPA056900) Datasheet (External Link) |
Vendor Page | Anti HOXD1 pAb (ATL-HPA056900) at Atlas Antibodies |
Documents & Links for Anti HOXD1 pAb (ATL-HPA056900) | |
Datasheet | Anti HOXD1 pAb (ATL-HPA056900) Datasheet (External Link) |
Vendor Page | Anti HOXD1 pAb (ATL-HPA056900) |