Anti HOXD1 pAb (ATL-HPA056900)

Atlas Antibodies

Catalog No: ATL-HPA056900-25

• 
• 

Product Description

Protein Description: homeobox D1
Gene Name: HOXD1
Alternative Gene Name: HOX4, HOX4G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042448: 67%, ENSRNOG00000001572: 71%
Entrez Gene ID: 3231
Uniprot ID: Q9GZZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS
• Gene Sequence: REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS
• Gene ID - Mouse: ENSMUSG00000042448
• Gene ID - Rat: ENSRNOG00000001572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.