Anti HOXC9 pAb (ATL-HPA072160)

Atlas Antibodies

Catalog No: ATL-HPA072160-25

• 

Product Description

Protein Description: homeobox C9
Gene Name: HOXC9
Alternative Gene Name: HOX3, HOX3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036139: 100%, ENSRNOG00000016199: 100%
Entrez Gene ID: 3225
Uniprot ID: P31274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAY
• Gene Sequence: PSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAY
• Gene ID - Mouse: ENSMUSG00000036139
• Gene ID - Rat: ENSRNOG00000016199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.