Protein Description: homeobox C9
Gene Name: HOXC9
Alternative Gene Name: HOX3, HOX3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036139: 100%, ENSRNOG00000016199: 100%
Entrez Gene ID: 3225
Uniprot ID: P31274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXC9
Alternative Gene Name: HOX3, HOX3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036139: 100%, ENSRNOG00000016199: 100%
Entrez Gene ID: 3225
Uniprot ID: P31274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAY |
| Documents & Links for Anti HOXC9 pAb (ATL-HPA072160) | |
| Datasheet | Anti HOXC9 pAb (ATL-HPA072160) Datasheet (External Link) |
| Vendor Page | Anti HOXC9 pAb (ATL-HPA072160) at Atlas |
| Documents & Links for Anti HOXC9 pAb (ATL-HPA072160) | |
| Datasheet | Anti HOXC9 pAb (ATL-HPA072160) Datasheet (External Link) |
| Vendor Page | Anti HOXC9 pAb (ATL-HPA072160) |