Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA065019-25

• 
• 

Product Description

Protein Description: homeobox B13
Gene Name: HOXB13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049604: 90%, ENSRNOG00000007491: 90%
Entrez Gene ID: 10481
Uniprot ID: Q92826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRR
• Gene Sequence: GEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRR
• Gene ID - Mouse: ENSMUSG00000049604
• Gene ID - Rat: ENSRNOG00000007491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.