Protein Description: homeobox B13
Gene Name: HOXB13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049604: 90%, ENSRNOG00000007491: 90%
Entrez Gene ID: 10481
Uniprot ID: Q92826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXB13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049604: 90%, ENSRNOG00000007491: 90%
Entrez Gene ID: 10481
Uniprot ID: Q92826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRR |
Documents & Links for Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation) | |
Datasheet | Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation) at Atlas |
Documents & Links for Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation) | |
Datasheet | Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HOXB13 pAb (ATL-HPA065019 w/enhanced validation) |