Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation)

Catalog No:
ATL-HPA062852-25
$447.00

Description

Product Description

Protein Description: homeobox B13
Gene Name: HOXB13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049604: 94%, ENSRNOG00000007491: 95%
Entrez Gene ID: 10481
Uniprot ID: Q92826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY
Gene Sequence YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY
Gene ID - Mouse ENSMUSG00000049604
Gene ID - Rat ENSRNOG00000007491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation)
Datasheet Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation)

Product Description

Protein Description: homeobox B13
Gene Name: HOXB13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049604: 94%, ENSRNOG00000007491: 95%
Entrez Gene ID: 10481
Uniprot ID: Q92826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY
Gene Sequence YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY
Gene ID - Mouse ENSMUSG00000049604
Gene ID - Rat ENSRNOG00000007491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation)
Datasheet Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HOXB13 pAb (ATL-HPA062852 w/enhanced validation)