Protein Description: homeobox A7
Gene Name: HOXA7
Alternative Gene Name: HOX1, HOX1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038236: 94%, ENSRNOG00000060292: 94%
Entrez Gene ID: 3204
Uniprot ID: P31268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXA7
Alternative Gene Name: HOX1, HOX1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038236: 94%, ENSRNOG00000060292: 94%
Entrez Gene ID: 3204
Uniprot ID: P31268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VNALFSKYTAGTSLFQNAEPTSCSFAPNSQRSGYGA |
| Documents & Links for Anti HOXA7 pAb (ATL-HPA074048) | |
| Datasheet | Anti HOXA7 pAb (ATL-HPA074048) Datasheet (External Link) |
| Vendor Page | Anti HOXA7 pAb (ATL-HPA074048) at Atlas |
| Documents & Links for Anti HOXA7 pAb (ATL-HPA074048) | |
| Datasheet | Anti HOXA7 pAb (ATL-HPA074048) Datasheet (External Link) |
| Vendor Page | Anti HOXA7 pAb (ATL-HPA074048) |