Anti HOXA4 pAb (ATL-HPA060088)

Atlas Antibodies

Catalog No: ATL-HPA060088-100

• 
• 
• 

Product Description

Protein Description: homeobox A4
Gene Name: HOXA4
Alternative Gene Name: HOX1, HOX1D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000942: 81%, ENSRNOG00000057095: 81%
Entrez Gene ID: 3201
Uniprot ID: Q00056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
• Gene Sequence: NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
• Gene ID - Mouse: ENSMUSG00000000942
• Gene ID - Rat: ENSRNOG00000057095
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.