Description
Product Description
Protein Description: heterogeneous nuclear ribonucleoprotein U-like 2
Gene Name: HNRNPUL2
Alternative Gene Name: DKFZp762N1910, HNRPUL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071659: 98%, ENSRNOG00000019507: 98%
Entrez Gene ID: 221092
Uniprot ID: Q1KMD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HNRNPUL2
Alternative Gene Name: DKFZp762N1910, HNRPUL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071659: 98%, ENSRNOG00000019507: 98%
Entrez Gene ID: 221092
Uniprot ID: Q1KMD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGAR |
Gene Sequence | QDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGAR |
Gene ID - Mouse | ENSMUSG00000071659 |
Gene ID - Rat | ENSRNOG00000019507 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HNRNPUL2 pAb (ATL-HPA056696) | |
Datasheet | Anti HNRNPUL2 pAb (ATL-HPA056696) Datasheet (External Link) |
Vendor Page | Anti HNRNPUL2 pAb (ATL-HPA056696) at Atlas Antibodies |
Documents & Links for Anti HNRNPUL2 pAb (ATL-HPA056696) | |
Datasheet | Anti HNRNPUL2 pAb (ATL-HPA056696) Datasheet (External Link) |
Vendor Page | Anti HNRNPUL2 pAb (ATL-HPA056696) |