Description
Product Description
Protein Description: heterogeneous nuclear ribonucleoprotein F
Gene Name: HNRNPF
Alternative Gene Name: HNRPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042079: 94%, ENSRNOG00000014562: 94%
Entrez Gene ID: 3185
Uniprot ID: P52597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HNRNPF
Alternative Gene Name: HNRPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042079: 94%, ENSRNOG00000014562: 94%
Entrez Gene ID: 3185
Uniprot ID: P52597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS |
Gene Sequence | TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS |
Gene ID - Mouse | ENSMUSG00000042079 |
Gene ID - Rat | ENSRNOG00000014562 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HNRNPF pAb (ATL-HPA069667) | |
Datasheet | Anti HNRNPF pAb (ATL-HPA069667) Datasheet (External Link) |
Vendor Page | Anti HNRNPF pAb (ATL-HPA069667) at Atlas Antibodies |
Documents & Links for Anti HNRNPF pAb (ATL-HPA069667) | |
Datasheet | Anti HNRNPF pAb (ATL-HPA069667) Datasheet (External Link) |
Vendor Page | Anti HNRNPF pAb (ATL-HPA069667) |