Anti HNRNPF pAb (ATL-HPA069667)

Atlas Antibodies

Catalog No: ATL-HPA069667-25

• 
• 

Product Description

Protein Description: heterogeneous nuclear ribonucleoprotein F
Gene Name: HNRNPF
Alternative Gene Name: HNRPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042079: 94%, ENSRNOG00000014562: 94%
Entrez Gene ID: 3185
Uniprot ID: P52597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS
• Gene Sequence: TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS
• Gene ID - Mouse: ENSMUSG00000042079
• Gene ID - Rat: ENSRNOG00000014562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.