Protein Description: heterogeneous nuclear ribonucleoprotein D-like
Gene Name: HNRNPDL
Alternative Gene Name: HNRPDL, JKTBP, laAUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029328: 100%, ENSRNOG00000002270: 100%
Entrez Gene ID: 9987
Uniprot ID: O14979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HNRNPDL
Alternative Gene Name: HNRPDL, JKTBP, laAUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029328: 100%, ENSRNOG00000002270: 100%
Entrez Gene ID: 9987
Uniprot ID: O14979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSA |
| Documents & Links for Anti HNRNPDL pAb (ATL-HPA063147) | |
| Datasheet | Anti HNRNPDL pAb (ATL-HPA063147) Datasheet (External Link) |
| Vendor Page | Anti HNRNPDL pAb (ATL-HPA063147) at Atlas |
| Documents & Links for Anti HNRNPDL pAb (ATL-HPA063147) | |
| Datasheet | Anti HNRNPDL pAb (ATL-HPA063147) Datasheet (External Link) |
| Vendor Page | Anti HNRNPDL pAb (ATL-HPA063147) |
| Citations for Anti HNRNPDL pAb (ATL-HPA063147) – 1 Found |
| Zhang, Qingyang; Zhang, Juan; Ye, Jin; Li, Xiaohui; Liu, Hongda; Ma, Xiaolin; Wang, Chao; He, Keqiang; Zhang, Wei; Yuan, Ji; Zhao, Yingjun; Xu, Huaxi; Liu, Qiang. Nuclear speckle specific hnRNP D-like prevents age- and AD-related cognitive decline by modulating RNA splicing. Molecular Neurodegeneration. 2021;16(1):66. PubMed |