Protein Description: heterogeneous nuclear ribonucleoprotein A3
Gene Name: HNRNPA3
Alternative Gene Name: HNRPA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059005: 100%, ENSRNOG00000052968: 100%
Entrez Gene ID: 220988
Uniprot ID: P51991
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HNRNPA3
Alternative Gene Name: HNRPA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059005: 100%, ENSRNOG00000052968: 100%
Entrez Gene ID: 220988
Uniprot ID: P51991
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQL |
| Documents & Links for Anti HNRNPA3 pAb (ATL-HPA066381) | |
| Datasheet | Anti HNRNPA3 pAb (ATL-HPA066381) Datasheet (External Link) |
| Vendor Page | Anti HNRNPA3 pAb (ATL-HPA066381) at Atlas |
| Documents & Links for Anti HNRNPA3 pAb (ATL-HPA066381) | |
| Datasheet | Anti HNRNPA3 pAb (ATL-HPA066381) Datasheet (External Link) |
| Vendor Page | Anti HNRNPA3 pAb (ATL-HPA066381) |