Protein Description: H6 family homeobox 3
Gene Name: HMX3
Alternative Gene Name: NKX5-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040148: 100%, ENSRNOG00000020637: 100%
Entrez Gene ID: 340784
Uniprot ID: A6NHT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HMX3
Alternative Gene Name: NKX5-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040148: 100%, ENSRNOG00000020637: 100%
Entrez Gene ID: 340784
Uniprot ID: A6NHT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTP |
Documents & Links for Anti HMX3 pAb (ATL-HPA069659) | |
Datasheet | Anti HMX3 pAb (ATL-HPA069659) Datasheet (External Link) |
Vendor Page | Anti HMX3 pAb (ATL-HPA069659) at Atlas |
Documents & Links for Anti HMX3 pAb (ATL-HPA069659) | |
Datasheet | Anti HMX3 pAb (ATL-HPA069659) Datasheet (External Link) |
Vendor Page | Anti HMX3 pAb (ATL-HPA069659) |