Protein Description: HMG-box containing 4
Gene Name: HMGXB4
Alternative Gene Name: HMG2L1, THC211630
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034518: 98%, ENSRNOG00000013878: 96%
Entrez Gene ID: 10042
Uniprot ID: Q9UGU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HMGXB4
Alternative Gene Name: HMG2L1, THC211630
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034518: 98%, ENSRNOG00000013878: 96%
Entrez Gene ID: 10042
Uniprot ID: Q9UGU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPT |
| Documents & Links for Anti HMGXB4 pAb (ATL-HPA076681) | |
| Datasheet | Anti HMGXB4 pAb (ATL-HPA076681) Datasheet (External Link) |
| Vendor Page | Anti HMGXB4 pAb (ATL-HPA076681) at Atlas |
| Documents & Links for Anti HMGXB4 pAb (ATL-HPA076681) | |
| Datasheet | Anti HMGXB4 pAb (ATL-HPA076681) Datasheet (External Link) |
| Vendor Page | Anti HMGXB4 pAb (ATL-HPA076681) |