Anti HMCN2 pAb (ATL-HPA070647)

Atlas Antibodies

Catalog No: ATL-HPA070647-25

• 

Product Description

Protein Description: hemicentin 2
Gene Name: HMCN2
Alternative Gene Name: DKFZp434P0216, FLJ23816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055632: 75%, ENSRNOG00000019356: 36%
Entrez Gene ID: 256158
Uniprot ID: Q8NDA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGSMTGVINGRK
• Gene Sequence: PTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGSMTGVINGRK
• Gene ID - Mouse: ENSMUSG00000055632
• Gene ID - Rat: ENSRNOG00000019356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.