Protein Description: hemicentin 1
Gene Name: HMCN1
Alternative Gene Name: ARMD1, FBLN6, FIBL-6, FIBL6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066842: 93%, ENSRNOG00000028627: 93%
Entrez Gene ID: 83872
Uniprot ID: Q96RW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HMCN1
Alternative Gene Name: ARMD1, FBLN6, FIBL-6, FIBL6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066842: 93%, ENSRNOG00000028627: 93%
Entrez Gene ID: 83872
Uniprot ID: Q96RW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQK |
| Documents & Links for Anti HMCN1 pAb (ATL-HPA008220) | |
| Datasheet | Anti HMCN1 pAb (ATL-HPA008220) Datasheet (External Link) |
| Vendor Page | Anti HMCN1 pAb (ATL-HPA008220) at Atlas |
| Documents & Links for Anti HMCN1 pAb (ATL-HPA008220) | |
| Datasheet | Anti HMCN1 pAb (ATL-HPA008220) Datasheet (External Link) |
| Vendor Page | Anti HMCN1 pAb (ATL-HPA008220) |