Anti HLF pAb (ATL-HPA071210)

Catalog No:
ATL-HPA071210-25
$303.00

Description

Product Description

Protein Description: hepatic leukemia factor
Gene Name: HLF
Alternative Gene Name: MGC33822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003949: 98%, ENSRNOG00000002456: 96%
Entrez Gene ID: 3131
Uniprot ID: Q16534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP
Gene Sequence VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP
Gene ID - Mouse ENSMUSG00000003949
Gene ID - Rat ENSRNOG00000002456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HLF pAb (ATL-HPA071210)
Datasheet Anti HLF pAb (ATL-HPA071210) Datasheet (External Link)
Vendor Page Anti HLF pAb (ATL-HPA071210) at Atlas Antibodies

Documents & Links for Anti HLF pAb (ATL-HPA071210)
Datasheet Anti HLF pAb (ATL-HPA071210) Datasheet (External Link)
Vendor Page Anti HLF pAb (ATL-HPA071210)

Product Description

Protein Description: hepatic leukemia factor
Gene Name: HLF
Alternative Gene Name: MGC33822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003949: 98%, ENSRNOG00000002456: 96%
Entrez Gene ID: 3131
Uniprot ID: Q16534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP
Gene Sequence VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP
Gene ID - Mouse ENSMUSG00000003949
Gene ID - Rat ENSRNOG00000002456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HLF pAb (ATL-HPA071210)
Datasheet Anti HLF pAb (ATL-HPA071210) Datasheet (External Link)
Vendor Page Anti HLF pAb (ATL-HPA071210) at Atlas Antibodies

Documents & Links for Anti HLF pAb (ATL-HPA071210)
Datasheet Anti HLF pAb (ATL-HPA071210) Datasheet (External Link)
Vendor Page Anti HLF pAb (ATL-HPA071210)