Description
Product Description
Protein Description: hepatic leukemia factor
Gene Name: HLF
Alternative Gene Name: MGC33822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003949: 98%, ENSRNOG00000002456: 96%
Entrez Gene ID: 3131
Uniprot ID: Q16534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HLF
Alternative Gene Name: MGC33822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003949: 98%, ENSRNOG00000002456: 96%
Entrez Gene ID: 3131
Uniprot ID: Q16534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP |
Gene Sequence | VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP |
Gene ID - Mouse | ENSMUSG00000003949 |
Gene ID - Rat | ENSRNOG00000002456 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HLF pAb (ATL-HPA071210) | |
Datasheet | Anti HLF pAb (ATL-HPA071210) Datasheet (External Link) |
Vendor Page | Anti HLF pAb (ATL-HPA071210) at Atlas Antibodies |
Documents & Links for Anti HLF pAb (ATL-HPA071210) | |
Datasheet | Anti HLF pAb (ATL-HPA071210) Datasheet (External Link) |
Vendor Page | Anti HLF pAb (ATL-HPA071210) |