Protein Description: hepatic leukemia factor
Gene Name: HLF
Alternative Gene Name: MGC33822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003949: 94%, ENSRNOG00000002456: 94%
Entrez Gene ID: 3131
Uniprot ID: Q16534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HLF
Alternative Gene Name: MGC33822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003949: 94%, ENSRNOG00000002456: 94%
Entrez Gene ID: 3131
Uniprot ID: Q16534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTF |
| Documents & Links for Anti HLF pAb (ATL-HPA068156) | |
| Datasheet | Anti HLF pAb (ATL-HPA068156) Datasheet (External Link) |
| Vendor Page | Anti HLF pAb (ATL-HPA068156) at Atlas |
| Documents & Links for Anti HLF pAb (ATL-HPA068156) | |
| Datasheet | Anti HLF pAb (ATL-HPA068156) Datasheet (External Link) |
| Vendor Page | Anti HLF pAb (ATL-HPA068156) |