Protein Description: major histocompatibility complex, class II, DR alpha
Gene Name: HLA-DRA
Alternative Gene Name: HLA-DRA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024334: 41%, ENSRNOG00000032844: 83%
Entrez Gene ID: 3122
Uniprot ID: P01903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HLA-DRA
Alternative Gene Name: HLA-DRA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024334: 41%, ENSRNOG00000032844: 83%
Entrez Gene ID: 3122
Uniprot ID: P01903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK |
| Documents & Links for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) | |
| Datasheet | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) at Atlas |
| Documents & Links for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) | |
| Datasheet | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) |
| Citations for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) – 1 Found |
| Balakrishnan, Carol K; Tye, Gee Jun; Balasubramaniam, Shandra Devi; Kaur, Gurjeet. CD74 and HLA-DRA in Cervical Carcinogenesis: Potential Targets for Antitumour Therapy. Medicina (Kaunas, Lithuania). 2022;58(2) PubMed |