Description
Product Description
Protein Description: major histocompatibility complex, class II, DQ beta 2
Gene Name: HLA-DQB2
Alternative Gene Name: HLA-DXB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060586: 52%, ENSRNOG00000033215: 50%
Entrez Gene ID: 3120
Uniprot ID: P05538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HLA-DQB2
Alternative Gene Name: HLA-DXB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060586: 52%, ENSRNOG00000033215: 50%
Entrez Gene ID: 3120
Uniprot ID: P05538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS |
Gene Sequence | GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS |
Gene ID - Mouse | ENSMUSG00000060586 |
Gene ID - Rat | ENSRNOG00000033215 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HLA-DQB2 pAb (ATL-HPA073187 w/enhanced validation) | |
Datasheet | Anti HLA-DQB2 pAb (ATL-HPA073187 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HLA-DQB2 pAb (ATL-HPA073187 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HLA-DQB2 pAb (ATL-HPA073187 w/enhanced validation) | |
Datasheet | Anti HLA-DQB2 pAb (ATL-HPA073187 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HLA-DQB2 pAb (ATL-HPA073187 w/enhanced validation) |