Anti HKDC1 pAb (ATL-HPA064230)

Atlas Antibodies

Catalog No: ATL-HPA064230-25

• 

Product Description

Protein Description: hexokinase domain containing 1
Gene Name: HKDC1
Alternative Gene Name: FLJ22761, FLJ37767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020080: 84%, ENSRNOG00000006116: 46%
Entrez Gene ID: 80201
Uniprot ID: Q2TB90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQAQRKQIDRVLALFQLTREQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEK
• Gene Sequence: VQAQRKQIDRVLALFQLTREQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEK
• Gene ID - Mouse: ENSMUSG00000020080
• Gene ID - Rat: ENSRNOG00000006116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.