Protein Description: human immunodeficiency virus type I enhancer binding protein 1
Gene Name: HIVEP1
Alternative Gene Name: CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021366: 62%, ENSRNOG00000014460: 60%
Entrez Gene ID: 3096
Uniprot ID: P15822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HIVEP1
Alternative Gene Name: CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021366: 62%, ENSRNOG00000014460: 60%
Entrez Gene ID: 3096
Uniprot ID: P15822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CFSGVHTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKAV |
Documents & Links for Anti HIVEP1 pAb (ATL-HPA067457) | |
Datasheet | Anti HIVEP1 pAb (ATL-HPA067457) Datasheet (External Link) |
Vendor Page | Anti HIVEP1 pAb (ATL-HPA067457) at Atlas |
Documents & Links for Anti HIVEP1 pAb (ATL-HPA067457) | |
Datasheet | Anti HIVEP1 pAb (ATL-HPA067457) Datasheet (External Link) |
Vendor Page | Anti HIVEP1 pAb (ATL-HPA067457) |