Anti HIRIP3 pAb (ATL-HPA063205)

Catalog No:
ATL-HPA063205-25
$303.00

Description

Product Description

Protein Description: HIRA interacting protein 3
Gene Name: HIRIP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042606: 67%, ENSRNOG00000029061: 27%
Entrez Gene ID: 8479
Uniprot ID: Q9BW71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKKGKRPPTPCSDPE
Gene Sequence KEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKKGKRPPTPCSDPE
Gene ID - Mouse ENSMUSG00000042606
Gene ID - Rat ENSRNOG00000029061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HIRIP3 pAb (ATL-HPA063205)
Datasheet Anti HIRIP3 pAb (ATL-HPA063205) Datasheet (External Link)
Vendor Page Anti HIRIP3 pAb (ATL-HPA063205) at Atlas Antibodies

Documents & Links for Anti HIRIP3 pAb (ATL-HPA063205)
Datasheet Anti HIRIP3 pAb (ATL-HPA063205) Datasheet (External Link)
Vendor Page Anti HIRIP3 pAb (ATL-HPA063205)

Product Description

Protein Description: HIRA interacting protein 3
Gene Name: HIRIP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042606: 67%, ENSRNOG00000029061: 27%
Entrez Gene ID: 8479
Uniprot ID: Q9BW71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKKGKRPPTPCSDPE
Gene Sequence KEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKKGKRPPTPCSDPE
Gene ID - Mouse ENSMUSG00000042606
Gene ID - Rat ENSRNOG00000029061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HIRIP3 pAb (ATL-HPA063205)
Datasheet Anti HIRIP3 pAb (ATL-HPA063205) Datasheet (External Link)
Vendor Page Anti HIRIP3 pAb (ATL-HPA063205) at Atlas Antibodies

Documents & Links for Anti HIRIP3 pAb (ATL-HPA063205)
Datasheet Anti HIRIP3 pAb (ATL-HPA063205) Datasheet (External Link)
Vendor Page Anti HIRIP3 pAb (ATL-HPA063205)