Protein Description: HIRA interacting protein 3
Gene Name: HIRIP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042606: 67%, ENSRNOG00000029061: 27%
Entrez Gene ID: 8479
Uniprot ID: Q9BW71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HIRIP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042606: 67%, ENSRNOG00000029061: 27%
Entrez Gene ID: 8479
Uniprot ID: Q9BW71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKKGKRPPTPCSDPE |
Documents & Links for Anti HIRIP3 pAb (ATL-HPA063205) | |
Datasheet | Anti HIRIP3 pAb (ATL-HPA063205) Datasheet (External Link) |
Vendor Page | Anti HIRIP3 pAb (ATL-HPA063205) at Atlas |
Documents & Links for Anti HIRIP3 pAb (ATL-HPA063205) | |
Datasheet | Anti HIRIP3 pAb (ATL-HPA063205) Datasheet (External Link) |
Vendor Page | Anti HIRIP3 pAb (ATL-HPA063205) |