Protein Description: hypoxia inducible lipid droplet-associated
Gene Name: HILPDA
Alternative Gene Name: C7orf68, FLJ21076, HIG-2, HIG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043421: 76%, ENSRNOG00000054999: 68%
Entrez Gene ID: 29923
Uniprot ID: Q9Y5L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HILPDA
Alternative Gene Name: C7orf68, FLJ21076, HIG-2, HIG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043421: 76%, ENSRNOG00000054999: 68%
Entrez Gene ID: 29923
Uniprot ID: Q9Y5L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM |
| Documents & Links for Anti HILPDA pAb (ATL-HPA010515) | |
| Datasheet | Anti HILPDA pAb (ATL-HPA010515) Datasheet (External Link) |
| Vendor Page | Anti HILPDA pAb (ATL-HPA010515) at Atlas |
| Documents & Links for Anti HILPDA pAb (ATL-HPA010515) | |
| Datasheet | Anti HILPDA pAb (ATL-HPA010515) Datasheet (External Link) |
| Vendor Page | Anti HILPDA pAb (ATL-HPA010515) |