![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/99958/179683/atl-hpa067080_anti-hibch-pab-atl-hpa067080_61345__59512.1681135433.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99958/179683/atl-hpa067080_anti-hibch-pab-atl-hpa067080_61345__59512.1681135433.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: 3-hydroxyisobutyryl-CoA hydrolase
Gene Name: HIBCH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041426: 81%, ENSRNOG00000028557: 81%
Entrez Gene ID: 26275
Uniprot ID: Q6NVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HIBCH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041426: 81%, ENSRNOG00000028557: 81%
Entrez Gene ID: 26275
Uniprot ID: Q6NVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLSVH |
| Documents & Links for Anti HIBCH pAb (ATL-HPA067080) | |
| Datasheet | Anti HIBCH pAb (ATL-HPA067080) Datasheet (External Link) |
| Vendor Page | Anti HIBCH pAb (ATL-HPA067080) at Atlas |
| Documents & Links for Anti HIBCH pAb (ATL-HPA067080) | |
| Datasheet | Anti HIBCH pAb (ATL-HPA067080) Datasheet (External Link) |
| Vendor Page | Anti HIBCH pAb (ATL-HPA067080) |