Anti HHLA1 pAb (ATL-HPA059051)

Atlas Antibodies

Catalog No: ATL-HPA059051-25

• 

Product Description

Protein Description: HERV-H LTR-associating 1
Gene Name: HHLA1
Alternative Gene Name: PLA2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072511: 89%, ENSRNOG00000054588: 89%
Entrez Gene ID: 10086
Uniprot ID: C9JL84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISNLKTVDPAKFPTRYCYCLNNRTNDLSDFTALLVDIIGNSTSYLTEIFKSTSILSVNQSNESDCIFICVMTGKSGRNLSDFWEI
• Gene Sequence: ISNLKTVDPAKFPTRYCYCLNNRTNDLSDFTALLVDIIGNSTSYLTEIFKSTSILSVNQSNESDCIFICVMTGKSGRNLSDFWEI
• Gene ID - Mouse: ENSMUSG00000072511
• Gene ID - Rat: ENSRNOG00000054588
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.