Anti HEYL pAb (ATL-HPA076960)

Catalog No:
ATL-HPA076960-25
$303.00

Description

Product Description

Protein Description: hes related family bHLH transcription factor with YRPW motif-like
Gene Name: HEYL
Alternative Gene Name: bHLHb33, HESR3, HEY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032744: 86%, ENSRNOG00000015318: 86%
Entrez Gene ID: 26508
Uniprot ID: Q9NQ87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
Gene Sequence MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
Gene ID - Mouse ENSMUSG00000032744
Gene ID - Rat ENSRNOG00000015318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HEYL pAb (ATL-HPA076960)
Datasheet Anti HEYL pAb (ATL-HPA076960) Datasheet (External Link)
Vendor Page Anti HEYL pAb (ATL-HPA076960) at Atlas Antibodies

Documents & Links for Anti HEYL pAb (ATL-HPA076960)
Datasheet Anti HEYL pAb (ATL-HPA076960) Datasheet (External Link)
Vendor Page Anti HEYL pAb (ATL-HPA076960)

Product Description

Protein Description: hes related family bHLH transcription factor with YRPW motif-like
Gene Name: HEYL
Alternative Gene Name: bHLHb33, HESR3, HEY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032744: 86%, ENSRNOG00000015318: 86%
Entrez Gene ID: 26508
Uniprot ID: Q9NQ87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
Gene Sequence MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
Gene ID - Mouse ENSMUSG00000032744
Gene ID - Rat ENSRNOG00000015318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HEYL pAb (ATL-HPA076960)
Datasheet Anti HEYL pAb (ATL-HPA076960) Datasheet (External Link)
Vendor Page Anti HEYL pAb (ATL-HPA076960) at Atlas Antibodies

Documents & Links for Anti HEYL pAb (ATL-HPA076960)
Datasheet Anti HEYL pAb (ATL-HPA076960) Datasheet (External Link)
Vendor Page Anti HEYL pAb (ATL-HPA076960)