Protein Description: hes related family bHLH transcription factor with YRPW motif-like
Gene Name: HEYL
Alternative Gene Name: bHLHb33, HESR3, HEY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032744: 86%, ENSRNOG00000015318: 86%
Entrez Gene ID: 26508
Uniprot ID: Q9NQ87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HEYL
Alternative Gene Name: bHLHb33, HESR3, HEY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032744: 86%, ENSRNOG00000015318: 86%
Entrez Gene ID: 26508
Uniprot ID: Q9NQ87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII |
| Documents & Links for Anti HEYL pAb (ATL-HPA076960) | |
| Datasheet | Anti HEYL pAb (ATL-HPA076960) Datasheet (External Link) |
| Vendor Page | Anti HEYL pAb (ATL-HPA076960) at Atlas |
| Documents & Links for Anti HEYL pAb (ATL-HPA076960) | |
| Datasheet | Anti HEYL pAb (ATL-HPA076960) Datasheet (External Link) |
| Vendor Page | Anti HEYL pAb (ATL-HPA076960) |