Description
Product Description
Protein Description: hes-related family bHLH transcription factor with YRPW motif 2
Gene Name: HEY2
Alternative Gene Name: bHLHb32, HERP1, HESR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019789: 88%, ENSRNOG00000013364: 90%
Entrez Gene ID: 23493
Uniprot ID: Q9UBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HEY2
Alternative Gene Name: bHLHb32, HERP1, HESR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019789: 88%, ENSRNOG00000013364: 90%
Entrez Gene ID: 23493
Uniprot ID: Q9UBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK |
Gene Sequence | PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK |
Gene ID - Mouse | ENSMUSG00000019789 |
Gene ID - Rat | ENSRNOG00000013364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HEY2 pAb (ATL-HPA074851) | |
Datasheet | Anti HEY2 pAb (ATL-HPA074851) Datasheet (External Link) |
Vendor Page | Anti HEY2 pAb (ATL-HPA074851) at Atlas Antibodies |
Documents & Links for Anti HEY2 pAb (ATL-HPA074851) | |
Datasheet | Anti HEY2 pAb (ATL-HPA074851) Datasheet (External Link) |
Vendor Page | Anti HEY2 pAb (ATL-HPA074851) |