Protein Description: hes family bHLH transcription factor 1
Gene Name: HES1
Alternative Gene Name: bHLHb39, FLJ20408, HES-1, Hes1, HRY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022528: 99%, ENSRNOG00000001720: 97%
Entrez Gene ID: 3280
Uniprot ID: Q14469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HES1
Alternative Gene Name: bHLHb39, FLJ20408, HES-1, Hes1, HRY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022528: 99%, ENSRNOG00000001720: 97%
Entrez Gene ID: 3280
Uniprot ID: Q14469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG |
| Documents & Links for Anti HES1 pAb (ATL-HPA066929) | |
| Datasheet | Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link) |
| Vendor Page | Anti HES1 pAb (ATL-HPA066929) at Atlas |
| Documents & Links for Anti HES1 pAb (ATL-HPA066929) | |
| Datasheet | Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link) |
| Vendor Page | Anti HES1 pAb (ATL-HPA066929) |