Anti HES1 pAb (ATL-HPA066929)

Catalog No:
ATL-HPA066929-25
$395.00

Description

Product Description

Protein Description: hes family bHLH transcription factor 1
Gene Name: HES1
Alternative Gene Name: bHLHb39, FLJ20408, HES-1, Hes1, HRY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022528: 99%, ENSRNOG00000001720: 97%
Entrez Gene ID: 3280
Uniprot ID: Q14469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Gene Sequence PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Gene ID - Mouse ENSMUSG00000022528
Gene ID - Rat ENSRNOG00000001720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HES1 pAb (ATL-HPA066929)
Datasheet Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link)
Vendor Page Anti HES1 pAb (ATL-HPA066929) at Atlas Antibodies

Documents & Links for Anti HES1 pAb (ATL-HPA066929)
Datasheet Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link)
Vendor Page Anti HES1 pAb (ATL-HPA066929)

Product Description

Protein Description: hes family bHLH transcription factor 1
Gene Name: HES1
Alternative Gene Name: bHLHb39, FLJ20408, HES-1, Hes1, HRY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022528: 99%, ENSRNOG00000001720: 97%
Entrez Gene ID: 3280
Uniprot ID: Q14469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Gene Sequence PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Gene ID - Mouse ENSMUSG00000022528
Gene ID - Rat ENSRNOG00000001720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HES1 pAb (ATL-HPA066929)
Datasheet Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link)
Vendor Page Anti HES1 pAb (ATL-HPA066929) at Atlas Antibodies

Documents & Links for Anti HES1 pAb (ATL-HPA066929)
Datasheet Anti HES1 pAb (ATL-HPA066929) Datasheet (External Link)
Vendor Page Anti HES1 pAb (ATL-HPA066929)