Protein Description: HERPUD family member 2
Gene Name: HERPUD2
Alternative Gene Name: FLJ22313
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008429: 99%, ENSRNOG00000029995: 99%
Entrez Gene ID: 64224
Uniprot ID: Q9BSE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HERPUD2
Alternative Gene Name: FLJ22313
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008429: 99%, ENSRNOG00000029995: 99%
Entrez Gene ID: 64224
Uniprot ID: Q9BSE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSR |
| Documents & Links for Anti HERPUD2 pAb (ATL-HPA076087) | |
| Datasheet | Anti HERPUD2 pAb (ATL-HPA076087) Datasheet (External Link) |
| Vendor Page | Anti HERPUD2 pAb (ATL-HPA076087) at Atlas |
| Documents & Links for Anti HERPUD2 pAb (ATL-HPA076087) | |
| Datasheet | Anti HERPUD2 pAb (ATL-HPA076087) Datasheet (External Link) |
| Vendor Page | Anti HERPUD2 pAb (ATL-HPA076087) |