![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101258/181335/atl-hpa074166_anti-herc2-pab-atl-hpa074166_63003__04112.1681137640.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: HECT and RLD domain containing E3 ubiquitin protein ligase 2
Gene Name: HERC2
Alternative Gene Name: D15F37S1, jdf2, p528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030451: 99%, ENSRNOG00000013718: 99%
Entrez Gene ID: 8924
Uniprot ID: O95714
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HERC2
Alternative Gene Name: D15F37S1, jdf2, p528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030451: 99%, ENSRNOG00000013718: 99%
Entrez Gene ID: 8924
Uniprot ID: O95714
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSK |
| Documents & Links for Anti HERC2 pAb (ATL-HPA074166) | |
| Datasheet | Anti HERC2 pAb (ATL-HPA074166) Datasheet (External Link) |
| Vendor Page | Anti HERC2 pAb (ATL-HPA074166) at Atlas |
| Documents & Links for Anti HERC2 pAb (ATL-HPA074166) | |
| Datasheet | Anti HERC2 pAb (ATL-HPA074166) Datasheet (External Link) |
| Vendor Page | Anti HERC2 pAb (ATL-HPA074166) |