Anti HEPN1 pAb (ATL-HPA063054)

Atlas Antibodies

Catalog No: ATL-HPA063054-25

• 

Product Description

Protein Description: hepatocellular carcinoma, down-regulated 1
Gene Name: HEPN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068742: 27%, ENSRNOG00000007478: 27%
Entrez Gene ID: 641654
Uniprot ID: Q6WQI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLGIAPWVDGESELEFRRLGMQGPLEALRRRERNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQRPSLFI
• Gene Sequence: GLGIAPWVDGESELEFRRLGMQGPLEALRRRERNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQRPSLFI
• Gene ID - Mouse: ENSMUSG00000068742
• Gene ID - Rat: ENSRNOG00000007478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.