Immunohistochemistry analysis in human testis and pancreas tissues using HPA063242 antibody. Corresponding HELLS RNA-seq data are presented for the same tissues.

Anti HELLS pAb (ATL-HPA063242 w/enhanced validation)

Catalog No:
ATL-HPA063242-25
$401.00
Protein Description: helicase, lymphoid-specific
Gene Name: HELLS
Alternative Gene Name: LSH, Nbla10143, PASG, SMARCA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025001: 85%, ENSRNOG00000047692: 85%
Entrez Gene ID: 3070
Uniprot ID: Q9NRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV

Documents & Links for Anti HELLS pAb (ATL-HPA063242 w/enhanced validation)
Datasheet Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) at Atlas

Documents & Links for Anti HELLS pAb (ATL-HPA063242 w/enhanced validation)
Datasheet Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HELLS pAb (ATL-HPA063242 w/enhanced validation)

Citations for Anti HELLS pAb (ATL-HPA063242 w/enhanced validation) – 1 Found
Määttä, Tomi A; Rettel, Mandy; Sridharan, Sindhuja; Helm, Dominic; Kurzawa, Nils; Stein, Frank; Savitski, Mikhail M. Aggregation and disaggregation features of the human proteome. Molecular Systems Biology. 2020;16(10):e9500.  PubMed