Protein Description: heme binding protein 1
Gene Name: HEBP1
Alternative Gene Name: HBP, HEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042770: 87%, ENSRNOG00000000024: 87%
Entrez Gene ID: 50865
Uniprot ID: Q9NRV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HEBP1
Alternative Gene Name: HBP, HEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042770: 87%, ENSRNOG00000000024: 87%
Entrez Gene ID: 50865
Uniprot ID: Q9NRV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA |
Documents & Links for Anti HEBP1 pAb (ATL-HPA075277) | |
Datasheet | Anti HEBP1 pAb (ATL-HPA075277) Datasheet (External Link) |
Vendor Page | Anti HEBP1 pAb (ATL-HPA075277) at Atlas |
Documents & Links for Anti HEBP1 pAb (ATL-HPA075277) | |
Datasheet | Anti HEBP1 pAb (ATL-HPA075277) Datasheet (External Link) |
Vendor Page | Anti HEBP1 pAb (ATL-HPA075277) |