Protein Description: HEAT repeat containing 9
Gene Name: HEATR9
Alternative Gene Name: C17orf66, FLJ32830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018925: 58%, ENSRNOG00000037100: 57%
Entrez Gene ID: 256957
Uniprot ID: A2RTY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HEATR9
Alternative Gene Name: C17orf66, FLJ32830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018925: 58%, ENSRNOG00000037100: 57%
Entrez Gene ID: 256957
Uniprot ID: A2RTY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NKVLSVYEAPKTNVKAEPTRFQKEPENPEELTIQDFRLAKLNPLFIAKSITKVGQKKTPAFPPCCSKPRKHRPQVIGPWQPRIKKQL |
Documents & Links for Anti HEATR9 pAb (ATL-HPA023129) | |
Datasheet | Anti HEATR9 pAb (ATL-HPA023129) Datasheet (External Link) |
Vendor Page | Anti HEATR9 pAb (ATL-HPA023129) at Atlas |
Documents & Links for Anti HEATR9 pAb (ATL-HPA023129) | |
Datasheet | Anti HEATR9 pAb (ATL-HPA023129) Datasheet (External Link) |
Vendor Page | Anti HEATR9 pAb (ATL-HPA023129) |