Protein Description: HEAT repeat containing 4
Gene Name: HEATR4
Alternative Gene Name: MGC48595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090843: 64%, ENSRNOG00000038183: 62%
Entrez Gene ID: 399671
Uniprot ID: Q86WZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HEATR4
Alternative Gene Name: MGC48595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090843: 64%, ENSRNOG00000038183: 62%
Entrez Gene ID: 399671
Uniprot ID: Q86WZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EKKKPELLLPVYYRLPSYFQQAETVEIMPGNKSTEDIHEKTSLSQPQTQSYFRQVTPRAGKFAYSTDNTFEQEIYFDEVQIIHQIGAKRDQIVLENLNRYNKQLSKVFPETPEKWSAQAIPEASY |
Documents & Links for Anti HEATR4 pAb (ATL-HPA079348 w/enhanced validation) | |
Datasheet | Anti HEATR4 pAb (ATL-HPA079348 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HEATR4 pAb (ATL-HPA079348 w/enhanced validation) at Atlas |
Documents & Links for Anti HEATR4 pAb (ATL-HPA079348 w/enhanced validation) | |
Datasheet | Anti HEATR4 pAb (ATL-HPA079348 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HEATR4 pAb (ATL-HPA079348 w/enhanced validation) |