Anti HEATR3 pAb (ATL-HPA058579)

Atlas Antibodies

Catalog No: ATL-HPA058579-25

• 

Product Description

Protein Description: HEAT repeat containing 3
Gene Name: HEATR3
Alternative Gene Name: FLJ20718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031657: 86%, ENSRNOG00000015459: 80%
Entrez Gene ID: 55027
Uniprot ID: Q7Z4Q2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE
• Gene Sequence: TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE
• Gene ID - Mouse: ENSMUSG00000031657
• Gene ID - Rat: ENSRNOG00000015459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.