Description
Product Description
Protein Description: haloacid dehalogenase-like hydrolase domain containing 2
Gene Name: HDHD2
Alternative Gene Name: DKFZP564D1378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 83%, ENSRNOG00000043171: 86%
Entrez Gene ID: 84064
Uniprot ID: Q9H0R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HDHD2
Alternative Gene Name: DKFZP564D1378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 83%, ENSRNOG00000043171: 86%
Entrez Gene ID: 84064
Uniprot ID: Q9H0R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG |
Gene Sequence | KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG |
Gene ID - Mouse | ENSMUSG00000025421 |
Gene ID - Rat | ENSRNOG00000043171 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HDHD2 pAb (ATL-HPA059818) | |
Datasheet | Anti HDHD2 pAb (ATL-HPA059818) Datasheet (External Link) |
Vendor Page | Anti HDHD2 pAb (ATL-HPA059818) at Atlas Antibodies |
Documents & Links for Anti HDHD2 pAb (ATL-HPA059818) | |
Datasheet | Anti HDHD2 pAb (ATL-HPA059818) Datasheet (External Link) |
Vendor Page | Anti HDHD2 pAb (ATL-HPA059818) |