Anti HDHD2 pAb (ATL-HPA059818)

Catalog No:
ATL-HPA059818-25
$447.00

Description

Product Description

Protein Description: haloacid dehalogenase-like hydrolase domain containing 2
Gene Name: HDHD2
Alternative Gene Name: DKFZP564D1378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 83%, ENSRNOG00000043171: 86%
Entrez Gene ID: 84064
Uniprot ID: Q9H0R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG
Gene Sequence KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG
Gene ID - Mouse ENSMUSG00000025421
Gene ID - Rat ENSRNOG00000043171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HDHD2 pAb (ATL-HPA059818)
Datasheet Anti HDHD2 pAb (ATL-HPA059818) Datasheet (External Link)
Vendor Page Anti HDHD2 pAb (ATL-HPA059818) at Atlas Antibodies

Documents & Links for Anti HDHD2 pAb (ATL-HPA059818)
Datasheet Anti HDHD2 pAb (ATL-HPA059818) Datasheet (External Link)
Vendor Page Anti HDHD2 pAb (ATL-HPA059818)

Product Description

Protein Description: haloacid dehalogenase-like hydrolase domain containing 2
Gene Name: HDHD2
Alternative Gene Name: DKFZP564D1378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 83%, ENSRNOG00000043171: 86%
Entrez Gene ID: 84064
Uniprot ID: Q9H0R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG
Gene Sequence KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG
Gene ID - Mouse ENSMUSG00000025421
Gene ID - Rat ENSRNOG00000043171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HDHD2 pAb (ATL-HPA059818)
Datasheet Anti HDHD2 pAb (ATL-HPA059818) Datasheet (External Link)
Vendor Page Anti HDHD2 pAb (ATL-HPA059818) at Atlas Antibodies

Documents & Links for Anti HDHD2 pAb (ATL-HPA059818)
Datasheet Anti HDHD2 pAb (ATL-HPA059818) Datasheet (External Link)
Vendor Page Anti HDHD2 pAb (ATL-HPA059818)