Protein Description: histone deacetylase 6
Gene Name: HDAC6
Alternative Gene Name: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031161: 47%, ENSRNOG00000047281: 49%
Entrez Gene ID: 10013
Uniprot ID: Q9UBN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HDAC6
Alternative Gene Name: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031161: 47%, ENSRNOG00000047281: 49%
Entrez Gene ID: 10013
Uniprot ID: Q9UBN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA |
| Documents & Links for Anti HDAC6 pAb (ATL-HPA026321) | |
| Datasheet | Anti HDAC6 pAb (ATL-HPA026321) Datasheet (External Link) |
| Vendor Page | Anti HDAC6 pAb (ATL-HPA026321) at Atlas |
| Documents & Links for Anti HDAC6 pAb (ATL-HPA026321) | |
| Datasheet | Anti HDAC6 pAb (ATL-HPA026321) Datasheet (External Link) |
| Vendor Page | Anti HDAC6 pAb (ATL-HPA026321) |