Anti HDAC6 pAb (ATL-HPA003714)

Catalog No:
ATL-HPA003714-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: histone deacetylase 6
Gene Name: HDAC6
Alternative Gene Name: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031161: 72%, ENSRNOG00000047281: 69%
Entrez Gene ID: 10013
Uniprot ID: Q9UBN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHL

Documents & Links for Anti HDAC6 pAb (ATL-HPA003714)
Datasheet Anti HDAC6 pAb (ATL-HPA003714) Datasheet (External Link)
Vendor Page Anti HDAC6 pAb (ATL-HPA003714) at Atlas

Documents & Links for Anti HDAC6 pAb (ATL-HPA003714)
Datasheet Anti HDAC6 pAb (ATL-HPA003714) Datasheet (External Link)
Vendor Page Anti HDAC6 pAb (ATL-HPA003714)