Protein Description: histone deacetylase 6
Gene Name: HDAC6
Alternative Gene Name: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031161: 72%, ENSRNOG00000047281: 69%
Entrez Gene ID: 10013
Uniprot ID: Q9UBN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HDAC6
Alternative Gene Name: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031161: 72%, ENSRNOG00000047281: 69%
Entrez Gene ID: 10013
Uniprot ID: Q9UBN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHL |
Documents & Links for Anti HDAC6 pAb (ATL-HPA003714) | |
Datasheet | Anti HDAC6 pAb (ATL-HPA003714) Datasheet (External Link) |
Vendor Page | Anti HDAC6 pAb (ATL-HPA003714) at Atlas |
Documents & Links for Anti HDAC6 pAb (ATL-HPA003714) | |
Datasheet | Anti HDAC6 pAb (ATL-HPA003714) Datasheet (External Link) |
Vendor Page | Anti HDAC6 pAb (ATL-HPA003714) |