Protein Description: histone deacetylase 4
Gene Name: HDAC4
Alternative Gene Name: BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026313: 91%, ENSRNOG00000020372: 93%
Entrez Gene ID: 9759
Uniprot ID: P56524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HDAC4
Alternative Gene Name: BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026313: 91%, ENSRNOG00000020372: 93%
Entrez Gene ID: 9759
Uniprot ID: P56524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL |
Documents & Links for Anti HDAC4 pAb (ATL-HPA071448) | |
Datasheet | Anti HDAC4 pAb (ATL-HPA071448) Datasheet (External Link) |
Vendor Page | Anti HDAC4 pAb (ATL-HPA071448) at Atlas |
Documents & Links for Anti HDAC4 pAb (ATL-HPA071448) | |
Datasheet | Anti HDAC4 pAb (ATL-HPA071448) Datasheet (External Link) |
Vendor Page | Anti HDAC4 pAb (ATL-HPA071448) |