Anti HCK pAb (ATL-HPA063768)

Atlas Antibodies

Catalog No: ATL-HPA063768-25

• 

Product Description

Protein Description: HCK proto-oncogene, Src family tyrosine kinase
Gene Name: HCK
Alternative Gene Name: JTK9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003283: 87%, ENSRNOG00000009331: 87%
Entrez Gene ID: 3055
Uniprot ID: P08631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEK
• Gene Sequence: STFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEK
• Gene ID - Mouse: ENSMUSG00000003283
• Gene ID - Rat: ENSRNOG00000009331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.