Protein Description: HCK proto-oncogene, Src family tyrosine kinase
Gene Name: HCK
Alternative Gene Name: JTK9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003283: 87%, ENSRNOG00000009331: 87%
Entrez Gene ID: 3055
Uniprot ID: P08631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HCK
Alternative Gene Name: JTK9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003283: 87%, ENSRNOG00000009331: 87%
Entrez Gene ID: 3055
Uniprot ID: P08631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEK |
| Documents & Links for Anti HCK pAb (ATL-HPA063768) | |
| Datasheet | Anti HCK pAb (ATL-HPA063768) Datasheet (External Link) |
| Vendor Page | Anti HCK pAb (ATL-HPA063768) at Atlas |
| Documents & Links for Anti HCK pAb (ATL-HPA063768) | |
| Datasheet | Anti HCK pAb (ATL-HPA063768) Datasheet (External Link) |
| Vendor Page | Anti HCK pAb (ATL-HPA063768) |