Protein Description: HCLS1 associated protein X-1
Gene Name: HAX1
Alternative Gene Name: HCLSBP1, HS1BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027944: 90%, ENSRNOG00000016589: 30%
Entrez Gene ID: 10456
Uniprot ID: O00165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HAX1
Alternative Gene Name: HCLSBP1, HS1BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027944: 90%, ENSRNOG00000016589: 30%
Entrez Gene ID: 10456
Uniprot ID: O00165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEA |
| Documents & Links for Anti HAX1 pAb (ATL-HPA075289) | |
| Datasheet | Anti HAX1 pAb (ATL-HPA075289) Datasheet (External Link) |
| Vendor Page | Anti HAX1 pAb (ATL-HPA075289) at Atlas |
| Documents & Links for Anti HAX1 pAb (ATL-HPA075289) | |
| Datasheet | Anti HAX1 pAb (ATL-HPA075289) Datasheet (External Link) |
| Vendor Page | Anti HAX1 pAb (ATL-HPA075289) |