Anti HAPLN4 pAb (ATL-HPA055856)

Atlas Antibodies

Catalog No: ATL-HPA055856-25

• 

Product Description

Protein Description: hyaluronan and proteoglycan link protein 4
Gene Name: HAPLN4
Alternative Gene Name: BRAL2, KIAA1926
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007594: 79%, ENSRNOG00000049949: 75%
Entrez Gene ID: 404037
Uniprot ID: Q86UW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCF
• Gene Sequence: DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCF
• Gene ID - Mouse: ENSMUSG00000007594
• Gene ID - Rat: ENSRNOG00000049949
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.