Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)

Catalog No:
ATL-HPA072442-100
$596.00

Description

Product Description

Protein Description: hydroxyacid oxidase 1
Gene Name: HAO1
Alternative Gene Name: GOX, GOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027261: 86%, ENSRNOG00000004601: 88%
Entrez Gene ID: 54363
Uniprot ID: Q9UJM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
Gene Sequence LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
Gene ID - Mouse ENSMUSG00000027261
Gene ID - Rat ENSRNOG00000004601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)
Datasheet Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)
Datasheet Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)

Product Description

Protein Description: hydroxyacid oxidase 1
Gene Name: HAO1
Alternative Gene Name: GOX, GOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027261: 86%, ENSRNOG00000004601: 88%
Entrez Gene ID: 54363
Uniprot ID: Q9UJM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
Gene Sequence LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP
Gene ID - Mouse ENSMUSG00000027261
Gene ID - Rat ENSRNOG00000004601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)
Datasheet Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)
Datasheet Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation)