Description
Product Description
Protein Description: hydroxyacid oxidase 1
Gene Name: HAO1
Alternative Gene Name: GOX, GOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027261: 86%, ENSRNOG00000004601: 88%
Entrez Gene ID: 54363
Uniprot ID: Q9UJM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HAO1
Alternative Gene Name: GOX, GOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027261: 86%, ENSRNOG00000004601: 88%
Entrez Gene ID: 54363
Uniprot ID: Q9UJM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP |
Gene Sequence | LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLP |
Gene ID - Mouse | ENSMUSG00000027261 |
Gene ID - Rat | ENSRNOG00000004601 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) | |
Datasheet | Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) | |
Datasheet | Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HAO1 pAb (ATL-HPA072442 w/enhanced validation) |