Description
Product Description
Protein Description: hydroxyacylglutathione hydrolase-like
Gene Name: HAGHL
Alternative Gene Name: MGC2605
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061046: 84%, ENSRNOG00000019612: 90%
Entrez Gene ID: 84264
Uniprot ID: Q6PII5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HAGHL
Alternative Gene Name: MGC2605
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061046: 84%, ENSRNOG00000019612: 90%
Entrez Gene ID: 84264
Uniprot ID: Q6PII5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLT |
| Gene Sequence | KVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLT |
| Gene ID - Mouse | ENSMUSG00000061046 |
| Gene ID - Rat | ENSRNOG00000019612 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti HAGHL pAb (ATL-HPA074402) | |
| Datasheet | Anti HAGHL pAb (ATL-HPA074402) Datasheet (External Link) |
| Vendor Page | Anti HAGHL pAb (ATL-HPA074402) at Atlas Antibodies |
| Documents & Links for Anti HAGHL pAb (ATL-HPA074402) | |
| Datasheet | Anti HAGHL pAb (ATL-HPA074402) Datasheet (External Link) |
| Vendor Page | Anti HAGHL pAb (ATL-HPA074402) |