Protein Description: hydroxyacylglutathione hydrolase-like
Gene Name: HAGHL
Alternative Gene Name: MGC2605
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061046: 84%, ENSRNOG00000019612: 90%
Entrez Gene ID: 84264
Uniprot ID: Q6PII5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HAGHL
Alternative Gene Name: MGC2605
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061046: 84%, ENSRNOG00000019612: 90%
Entrez Gene ID: 84264
Uniprot ID: Q6PII5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLT |
Documents & Links for Anti HAGHL pAb (ATL-HPA074402) | |
Datasheet | Anti HAGHL pAb (ATL-HPA074402) Datasheet (External Link) |
Vendor Page | Anti HAGHL pAb (ATL-HPA074402) at Atlas |
Documents & Links for Anti HAGHL pAb (ATL-HPA074402) | |
Datasheet | Anti HAGHL pAb (ATL-HPA074402) Datasheet (External Link) |
Vendor Page | Anti HAGHL pAb (ATL-HPA074402) |