Protein Description: granzyme K
Gene Name: GZMK
Alternative Gene Name: PRSS, TRYP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042385: 68%, ENSRNOG00000010661: 66%
Entrez Gene ID: 3003
Uniprot ID: P49863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GZMK
Alternative Gene Name: PRSS, TRYP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042385: 68%, ENSRNOG00000010661: 66%
Entrez Gene ID: 3003
Uniprot ID: P49863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK |
Documents & Links for Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) | |
Datasheet | Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) at Atlas |
Documents & Links for Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) | |
Datasheet | Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GZMK pAb (ATL-HPA065895 w/enhanced validation) |