Anti GZMK pAb (ATL-HPA063181 w/enhanced validation)

Catalog No:
ATL-HPA063181-25
$360.00
Protein Description: granzyme K (granzyme 3; tryptase II)
Gene Name: GZMK
Alternative Gene Name: PRSS, TRYP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042385: 77%, ENSRNOG00000010661: 76%
Entrez Gene ID: 3003
Uniprot ID: P49863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS

Documents & Links for Anti GZMK pAb (ATL-HPA063181 w/enhanced validation)
Datasheet Anti GZMK pAb (ATL-HPA063181 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GZMK pAb (ATL-HPA063181 w/enhanced validation) at Atlas

Documents & Links for Anti GZMK pAb (ATL-HPA063181 w/enhanced validation)
Datasheet Anti GZMK pAb (ATL-HPA063181 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GZMK pAb (ATL-HPA063181 w/enhanced validation)

Citations for Anti GZMK pAb (ATL-HPA063181 w/enhanced validation) – 2 Found
Luca, Bogdan A; Steen, Chloé B; Matusiak, Magdalena; Azizi, Armon; Varma, Sushama; Zhu, Chunfang; Przybyl, Joanna; Espín-Pérez, Almudena; Diehn, Maximilian; Alizadeh, Ash A; van de Rijn, Matt; Gentles, Andrew J; Newman, Aaron M. Atlas of clinically distinct cell states and ecosystems across human solid tumors. Cell. 2021;184(21):5482-5496.e28.  PubMed
Han, Guangchun; Deng, Qing; Marques-Piubelli, Mario L; Dai, Enyu; Dang, Minghao; Ma, Man Chun John; Li, Xubin; Yang, Haopeng; Henderson, Jared; Kudryashova, Olga; Meerson, Mark; Isaev, Sergey; Kotlov, Nikita; Nomie, Krystle J; Bagaev, Alexander; Parra, Edwin R; Solis Soto, Luisa M; Parmar, Simrit; Hagemeister, Fredrick B; Ahmed, Sairah; Iyer, Swaminathan P; Samaniego, Felipe; Steiner, Raphael; Fayad, Luis; Lee, Hun; Fowler, Nathan H; Flowers, Christopher R; Strati, Paolo; Westin, Jason R; Neelapu, Sattva S; Nastoupil, Loretta J; Vega, Francisco; Wang, Linghua; Green, Michael R. Follicular Lymphoma Microenvironment Characteristics Associated with Tumor Cell Mutations and MHC Class II Expression. Blood Cancer Discovery. 2022;3(5):428-443.  PubMed