Protein Description: glycogenin 2
Gene Name: GYG2
Alternative Gene Name: GN-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032515: 27%, ENSRNOG00000002021: 28%
Entrez Gene ID: 8908
Uniprot ID: O15488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GYG2
Alternative Gene Name: GN-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032515: 27%, ENSRNOG00000002021: 28%
Entrez Gene ID: 8908
Uniprot ID: O15488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPE |
| Documents & Links for Anti GYG2 pAb (ATL-HPA064686 w/enhanced validation) | |
| Datasheet | Anti GYG2 pAb (ATL-HPA064686 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GYG2 pAb (ATL-HPA064686 w/enhanced validation) at Atlas |
| Documents & Links for Anti GYG2 pAb (ATL-HPA064686 w/enhanced validation) | |
| Datasheet | Anti GYG2 pAb (ATL-HPA064686 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GYG2 pAb (ATL-HPA064686 w/enhanced validation) |