![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101078/181122/atl-hpa073229_anti-gyg1-pab-atl-hpa073229_62790__21912.1681137376.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: glycogenin 1
Gene Name: GYG1
Alternative Gene Name: GYG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019528: 97%, ENSRNOG00000011146: 100%
Entrez Gene ID: 2992
Uniprot ID: P46976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GYG1
Alternative Gene Name: GYG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019528: 97%, ENSRNOG00000011146: 100%
Entrez Gene ID: 2992
Uniprot ID: P46976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP |
| Documents & Links for Anti GYG1 pAb (ATL-HPA073229) | |
| Datasheet | Anti GYG1 pAb (ATL-HPA073229) Datasheet (External Link) |
| Vendor Page | Anti GYG1 pAb (ATL-HPA073229) at Atlas |
| Documents & Links for Anti GYG1 pAb (ATL-HPA073229) | |
| Datasheet | Anti GYG1 pAb (ATL-HPA073229) Datasheet (External Link) |
| Vendor Page | Anti GYG1 pAb (ATL-HPA073229) |